PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG493600.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 735aa    MW: 82301 Da    PI: 6.6313
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG493600.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS387.61.4e-1183597301374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++ L++cA+av+++d + a++lL+++++++  +gd  qRla++f+ +L+arla+++s+ly++l +++t+    s+ l+a++l+  ++P+
  Pavir.9KG493600.4.p 359 LRTILIHCAQAVAADDRRTANELLKQIRHHSKTNGDGAQRLAHCFADGLEARLAGTGSQLYHKLVAKRTT---ASDMLKAYHLYLAACPF 445
                          5789************************************************************999999...9**************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           ++sh++ Nq+Il  ++++++vHiiDf+i  G+QWp+L++ L++R++gpp lRiTg++ p++g   +e++eetg+rLa++A+++gvpfe+
  Pavir.9KG493600.4.p 446 KRLSHFLSNQTILSMTKNASKVHIIDFGIYFGFQWPCLIRRLSKRDGGPPVLRITGIDVPQPGfrPTERIEETGQRLAEYAKKFGVPFEY 535
                          **************************************************************9*************************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          +  +a+++e++++e+L+v ++E+++Vn+ ++  +l de+v+++s+r++vL+++++++P ++++   + +++ + F +rf eal ++salf
  Pavir.9KG493600.4.p 536 QG-IASKWETIRVEDLKVGKDEVVIVNCLYRFRNLIDETVAVDSPRNRVLNTIRQVNPAIFIHGIVNGSYSVPFFITRFREALFHFSALF 624
                          **.7************************************************************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d+lea++pr++ +r+ +Er l+gre+ nv+aceg++r+er et+++W+ r  +aGF + pl+++++++ak  ++ ++ + + ++e+sg+l
  Pavir.9KG493600.4.p 625 DMLEATVPRDDAQRALLERDLFGREALNVIACEGSDRVERPETYKQWQVRNLRAGFVQSPLNQEIVMKAKDKVKDIYHKDFVIDEDSGWL 714
                          *****************************************************************************888********** PP

                 GRAS 359 vlgWkdrpLvsvSaWr 374
                          ++gWk+r ++++S W+
  Pavir.9KG493600.4.p 715 LQGWKGRIIYAISTWK 730
                          ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.17333710IPR005202Transcription factor GRAS
PfamPF035144.8E-116359730IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 735 aa     Download sequence    Send to blast
MGLDNTYGEL SGMFGGGLSY DGYTDHSSTS DYFRFSDPLP AVVPQMVAEP QSNPSSTVSR  60
ANTETDNPED WEFISDESLN YISRMLLEED IDEKVSMYQA ESVALRAAAK PFYDILGHKF  120
PPSPDHQLIP WSVESPSESC SNSCTQSVAS TVTGSSIGGA VDSNRLYDIG GCEQLEAYGG  180
LCGQSYQPLV GPSSDACSAV GVLEDPLITN GRIPEYLFES LPTWDFRRGI EEAQKFLPVS  240
NKLVFDLGSS GIARPQEARK DASSNARKAN VLNAKKNRQS EDLDLMEGRN IKQSAFCSDE  300
PDWIEMFDDL LRQTEKKATD LRELMRSEAS KNSQVTQTKG PSGPRTRGRK PTKKDVVDLR  360
TILIHCAQAV AADDRRTANE LLKQIRHHSK TNGDGAQRLA HCFADGLEAR LAGTGSQLYH  420
KLVAKRTTAS DMLKAYHLYL AACPFKRLSH FLSNQTILSM TKNASKVHII DFGIYFGFQW  480
PCLIRRLSKR DGGPPVLRIT GIDVPQPGFR PTERIEETGQ RLAEYAKKFG VPFEYQGIAS  540
KWETIRVEDL KVGKDEVVIV NCLYRFRNLI DETVAVDSPR NRVLNTIRQV NPAIFIHGIV  600
NGSYSVPFFI TRFREALFHF SALFDMLEAT VPRDDAQRAL LERDLFGREA LNVIACEGSD  660
RVERPETYKQ WQVRNLRAGF VQSPLNQEIV MKAKDKVKDI YHKDFVIDED SGWLLQGWKG  720
RIIYAISTWK PKNN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-503637308375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.49410.0callus| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7279710.0KJ727971.1 Zea mays clone pUT6085 GRAS transcription factor (GRAS67) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984720.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_004984721.10.0PREDICTED: scarecrow-like protein 9
TrEMBLK4A6B30.0K4A6B3_SETIT; Uncharacterized protein
STRINGSi034417m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein